HORDB

ID: hor001619
Uniprot ID: O15130
Protein name: Neuropeptide FF
Gene name: NPFF
Organism: Homo sapiens (Human)
Family: FARP (FMRFamide related peptide) family
Source: Human
Expression: NA
Disease: Diseases associated with NPFF include Migraine With Aura and Opiate Dependence.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0060079 excitatory postsynaptic potential
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030425 dendrite; GO:0043204 perikaryon; GO:0043679 axon terminus; GO:0098794 postsynapse

Sequence: FLFQPQRF
Length: 8
Propeptide: MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
Signal peptide: MDSRQAAALLVLLLLIDGGC
Modification: T8 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas; potentiates and sensitizes ASIC1 and ASIC4 channels.
Mechanism: NA
Cross BBB: NA
Target: NPFFR2, NPFFR1
Target Unid: Q9Y5X5, Q9GZQ6
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001619_AF2.pdb

hor001619_ESM.pdb

Mass:	120730	Formula:	C54H75N13O11
Absent amino acids:	ACDEGHIKMNSTVWY	Common amino acids:	F
pI:	10.55	Basic residues:	1
Polar residues:	0	Hydrophobic residues:	4
Hydrophobicity:	-11.25	Boman Index:	-1214
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	48.75
Instability Index:	5690	Extinction Coefficient cystines:	0
Absorbance 280nm:	0